Everything below concerns certificate of analysis. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2025-11-17. Where a claim depends on a specific study, the study is described rather than over-claimed.
The molecule consists of 28 amino acid residues with an acetyl group attached to the N-terminal serine. Its sequence is acidic overall, with several glutamic and aspartic acid residues distributed along the chain and no cysteine, so disulfide bridges do not form. The peptide carries a net negative charge at physiological pH. Because the N-terminus is blocked, the intact molecule resists degradation by many aminopeptidases, which contributes to its stability in biological fluids.
The peptide is generated in cells by cleavage of prothymosin alpha, a larger acidic protein encoded by the PTMA gene. Prothymosin alpha is expressed in many tissues, not only in the thymus, and its functions include nuclear roles in chromatin-related processes. The 28-residue fragment corresponds to the N-terminal portion of that precursor. How the cleavage occurs and how the fragment's concentration is regulated remain open questions; circulating amounts are small and difficult to measure reliably with routine assays.
Thymosin alpha 1 is a short peptide first isolated from bovine thymus tissue in the early 1970s during fractionation work aimed at identifying factors that influence T cell development. It belongs to a family of acidic thymic peptides, and the original preparations contained several components that were later separated by chromatography. The compound is now produced synthetically rather than extracted from tissue, which removes batch variability tied to animal sourcing. Researchers describe it as an immunomodulatory peptide because laboratory studies show effects on several cell types of the innate and adaptive immune systems.
Reverse-phase high-performance liquid chromatography is the standard technique for assessing purity and concentration, because the peptide's hydrophobicity allows clean separation from related impurities. Mass spectrometry confirms molecular identity and detects sequence errors or truncations. Amino acid analysis and peptide mapping supply additional structural confirmation when required. Chromatographic purity values reported on certificates of analysis describe the proportion of the main peak and do not by themselves establish biological activity.
Like most short peptides, thymosin alpha-1 is susceptible to hydrolysis under strongly acidic or basic conditions and to oxidation when exposed to air over long periods. The acetylated amino terminus blocks one common degradation route, which contributes to the molecule's relative robustness in solution. Lyophilized material generally retains potency for extended periods when kept cold and dry. Once reconstituted, aqueous solutions are less stable and are typically used within a defined window rather than held indefinitely at ambient temperature.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Acetylated peptide | N-terminal acetyl group blocks aminopeptidase attack |
| Residue count | 28 amino acids | Matches the N-terminus of prothymosin alpha |
| Molecular mass | About 3,108 Da | Value for the free, unmodified peptide |
| Isoelectric point | Approximately 4.2 | Acidic; net negative charge at neutral pH |
| Encoding gene | PTMA | Human gene for the precursor protein |
The peptide was identified during work in the 1970s on thymosin fraction 5, a partially purified extract of calf thymus. Investigators separated that mixture and characterized individual components, one of which they named thymosin alpha-1. The same compound later received the international nonproprietary name thymalfasin. Commercial material is produced by solid-phase peptide synthesis rather than by extraction, so synthetic and natural forms share an identical sequence. Naming conventions vary across the literature, and readers should distinguish the alpha-1 peptide from other thymosins that have unrelated sequences and functions.
Thymosin beta-4 is a separate 43-residue peptide that binds actin and participates in cell migration; it shares no sequence similarity with thymosin alpha-1 despite the common family name. Other preparative materials, such as thymosin fraction 5 and thymopoietin, contain distinct mixtures or peptides. The shared thymosin label reflects the tissue of origin used in early purification, not a common structural core. Treating these molecules as interchangeable is a frequent source of confusion in laboratory reports and in popular summaries alike.
Identity and purity are usually checked by reverse-phase high-performance liquid chromatography, which separates the intact chain from truncated products, together with mass spectrometry for confirmation of the expected mass. Peptide mapping after enzymatic digestion and amino acid analysis add sequence-level evidence. Release testing also covers water content, residual solvents, and counter-ions, all of which influence measured mass and stability. Related-peptide limits are commonly expressed as a percentage of total peak area, with individual unspecified impurities held below a lower threshold.
The lyophilized peptide is a white to off-white powder that dissolves freely in water and in aqueous buffers near neutral pH. Because the molecule carries a net negative charge under physiological conditions, saline and phosphate solutions are the usual vehicles, while strongly acidic media are avoided. Stock solutions are commonly divided into small aliquots so that repeated freezing and thawing can be limited, since cycling may encourage aggregation. Solubility in organic solvents is poor and those solvents are seldom used as primary diluents.
Early work on thymic extracts in the 1960s described a heat-stable acidic fraction containing many polypeptides. Separation of that mixture yielded individual components, and thymosin alpha-1 was named as one of them on the basis of assays for T-cell activity. The first preparations came from calf thymus, while subsequent research and clinical material has been chemically synthesized. Nomenclature in older papers is inconsistent, and the same peptide sometimes appears under different designations, which complicates literature searches.
Most published studies on thymosin alpha-1 report changes in immune measurements rather than clinical outcomes, and findings differ across designs and populations. Whether the peptide signals through one defined receptor or through several less specific interactions remains an open question. Its reported circulation half-life of a few hours complicates comparison of dosing schedules across trials. Mechanistic claims are frequently drawn from isolated cell cultures, and how far those results extend to whole organisms is unresolved.
Several factors accelerate degradation: alkaline pH, elevated temperature, exposure to oxidants, and the presence of residual moisture. Deamidation of asparagine residues and oxidation of methionine are the most commonly reported degradation routes. Because the peptide lacks disulfide bonds, it does not undergo the thiol-related aggregation seen in some other biologics, but physical aggregation can still occur at high concentration. Stability data are product-specific, and extrapolating shelf life between formulations is not reliable.
Lyophilized thymosin alpha-1 is generally stored at or below minus twenty degrees Celsius, protected from moisture and light. Short-term handling at ambient temperature is possible for dry powder, but reconstituted solutions degrade faster and are usually kept at two to eight degrees Celsius with a defined expiry of days rather than weeks. Repeated freeze-thaw cycles should be avoided because they promote aggregation and loss of potency. Exact limits depend on the formulation and should follow the supplier's documentation.
=== Connection to depression === There is evidence for a link between inflammation and depression. Inflammatory processes can be triggered by negative cognitions or their consequences, such as stress, violence, or deprivation. Thus, negative cognitions can cause inflammation that can, in turn, lead to depression. In addition, there is increasing evidence that inflammation can cause depression because of the increase of cytokines, setting the brain into a "sickness mode". Classical symptoms of being physically sick, such as lethargy, show a large overlap in behaviors that characterize depression. Levels of cytokines tend to increase sharply during the depressive episodes of people with bipolar disorder and drop off during remission. Furthermore, it has been shown in clinical trials that anti-inflammatory medicines taken in addition to antidepressants not only significantly improves symptoms but also increases the proportion of subjects positively responding to treatment. Inflammations that lead to serious depression could be caused by common infections such as those caused by a virus, bacteria or even parasites.
== Selected publications == Tiwari, V. Jin, Byungchang; Sun, Olivia; LopezGonzalez, Edwin D. J.; Chen, Min-Hsuan; Wu, Xiwei; Shah, Hardik; Zhang, Andrew; Herman, Mark A.; Spracklen, Cassandra N.; Goodman, Russell P.; Brenner, Charles (November 2025). "Glycerol-3-phosphate activates ChREBP, FGF21 transcription and lipogenesis in citrin deficiency". Nature Metabolism. 7 (11): 2284–2299. doi:10.1038/s42255-025-01399-3. ISSN 2522-5812. PMC 12638245 Brenner, C (2022-09-22). "Sirtuins are not conserved longevity genes". Life Metabolism (2): 122–133. doi:10.1093/lifemeta/loac025. ISSN 2755-0230. PMC 10081735. PMID 37035412. Brenner, C (January 2022). "Viral infection as an NAD+ battlefield". Nature Metabolism. 4 (1): 2–3. doi:10.1038/s42255-021-00507-3. ISSN 2522-5812. PMC 10155260. PMID 34980922. S2CID 245654307. Heer, CD; Sanderson, DJ; Voth, LS; Alhammad, YMO; Schmidt, MS; Trammell, SAJ; Perlman, S; Cohen, MS; Fehr, AR; Brenner, C (2020-10-13). "Coronavirus infection and PARP expression dysregulate the NAD Metabolome: an actionable component of innate immunity". Journal of Biological Chemistry. 295 (52): 17986–17996. doi:10.1074/jbc.RA120.015138. PMC 7834058. PMID 33051211. Vaur, P; Brugg, B; Mericskay, M; Li, Z; Schmidt, M S.; Vivien, D; Orset, C; Jacotot, E; Brenner, C (December 2017). "Nicotinamide riboside, a form of vitamin B3, protects against excitotoxicity-induced axonal degeneration". FASEB Journal. 31 (12): 5440–5452. doi:10.1096/fj.201700221RR. ISSN 1530-6860. PMID 28842432.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
==== Chemotaxis ==== Chemotaxis is the ability to direct movement through sensing a gradient of chemoattractants or chemorepellents using flagella, allowing bacteria to locate algal cells to lyse. Some algal cells can have intrinsic attractant properties, whereas others produce attractants. A common chemoattractant is dimethylsulfoniopropionate (DMSP). Additionally, chemotaxis allows for preferential "predation", as some organisms may prefer specific attractants. For instance, amino acids tend to be preferentially taken up by Polaribacter marinivivus and Lentibacter algarum, whereas nucleotides are preferentially taken up by Litoricola marina.
17 July – Members of Unison at 14 Scottish council areas, including Glasgow, Perth and Kinross and Dumfries and Galloway, vote to take industrial action after describing a pay offer from COSLA as "inadequate". 19 July – Unison rejects the latest offer from Cosla aimed at preventing strikes by refuse collectors, which was worth 3.2%. 21 July – Data from Public Health Scotland for the week ending 14 July indicates there were 1,130 cases of COVID-19 in Scotland, but the health body believes cases may have peaked. 22 July – Following the death of 17-year-old Jonathan Beadle at Polmont Young Offenders Institution on Saturday 13 July, the Scottish Government announces that nobody under the age of 18 will be kept in prison in Scotland from the week beginning 2 September. Unite and the GMB follow Unison in rejecting the latest pay offer for refuse workers from Cosla. 23 July – The family of Allan Marshall, who died after being restrained by 17 prison officers at HMP Edinburgh in 2015, are to sue the Scottish Government under human rights legislation in what is believed to be the first case of its kind. 24 July – Researchers from the Scottish Association for Marine Science report evidence of dark oxygen being produced from manganese nodules on the seafloor. It was previously assumed that almost all the free oxygen (O2) on Earth was created through photosynthesis, which requires sunlight. The research has since come under criticism for methodological and ethical issues.
Sources: en.wikipedia.org
A fascia (; pl.: fasciae or fascias; adjective fascial; from Latin fascia 'band') is a generic term for macroscopic membranous bodily structures. Fasciae are classified as superficial, visceral or deep, and further designated according to their anatomical location. The knowledge of fascial structures is essential in surgery, as they create borders for infectious processes (for example Psoas abscess) and haematoma. An increase in pressure may result in a compartment syndrome, where a prompt fasciotomy may be necessary. For this reason, profound descriptions of fascial structures are available in anatomical literature from the 19th century.
== Interactions == Collagen, type VII, alpha 1 forms a complex network with several other proteins in the basement membrane. It has been shown to interact with laminin 5 and fibronectin, as well as collagen IV, by binding these proteins in the NC-1 domain. The stability of the basement membrane and dermal-epidermal junction is thought to be due to these interactions.
Otherwise, the carbonyl branch is homologous between the two domains and consists of the reduction of another molecule of CO2 to a carbonyl residue bound to an enzyme, catalyzed by the CO dehydrogenase/acetyl-CoA synthase. This key enzyme is also the catalyst for the formation of acetyl-CoA starting from the products of the previous reactions, the methyl and the carbonyl residues. This carbon fixation pathway requires only one molecule of ATP for the production of one molecule of pyruvate, which makes this process one of the main choice for chemolithoautotrophs limited in energy and living in anaerobic conditions.
This is a shortened version of the second chapter of the ICD-9: Neoplasms. It covers ICD codes 140 to 239. The full chapter can be found on pages 101 to 144 of Volume 1, which contains all (sub)categories of the ICD-9. Volume 2 is an alphabetical index of Volume 1. Both volumes can be downloaded for free from the website of the World Health Organization. See here for a tabular overview of primary, secondary, in situ, and benign neoplasms.
Sources: en.wikipedia.org
Thymosin fraction 5 is a mixture of many peptides obtained from thymus tissue, while thymosin alpha 1 is a single defined 28-residue molecule. The two names appear together in older literature because the purified peptide was first obtained from that mixture.
The precursor, prothymosin alpha, is encoded by the PTMA gene in humans. The 28-residue peptide corresponds to the N-terminal segment released from that larger protein.
It is produced as a fragment of prothymosin alpha and is present in many tissues. Circulating concentrations are low, which makes routine measurement difficult.
The lyophilized solid is normally held at 2 to 8 °C in a sealed, light-protected container. Dry storage limits both hydrolysis and microbial growth. Material kept this way remains stable for the shelf life stated by the supplier.